PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Dca21615.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Caryophyllaceae; Caryophylleae; Dianthus
Family LBD
Protein Properties Length: 163aa    MW: 18102.7 Da    PI: 7.8416
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Dca21615.1genomeDCAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260144.43.3e-4591081100
      DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallke 99 
                 +Ca+Ck+lrr+CakdC++apyfp+++p+kfa+vhk+FGasnv+k+l++lp ++r da+sslvyeA+ar+rdPvyG+vg i+ lq+q++ql+ +la++++
  Dca21615.1   9 PCASCKLLRRRCAKDCTFAPYFPSDDPHKFAIVHKVFGASNVSKMLQELPVHQRADAVSSLVYEANARMRDPVYGCVGAISFLQNQVSQLQMQLAVAHA 107
                 7**********************************************************************************************9998 PP

      DUF260 100 e 100
                 e
  Dca21615.1 108 E 108
                 7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.4648109IPR004883Lateral organ boundaries, LOB
PfamPF031956.8E-449106IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 163 aa     Download sequence    Send to blast
MGANGTSSPC ASCKLLRRRC AKDCTFAPYF PSDDPHKFAI VHKVFGASNV SKMLQELPVH  60
QRADAVSSLV YEANARMRDP VYGCVGAISF LQNQVSQLQM QLAVAHAELL CIQMQQEPSN  120
ISNTAQSIFV SDNDKSFLFQ NSLSYNNHLY LESSISRHLT IIM
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010692935.12e-85PREDICTED: LOB domain-containing protein 12-like
SwissprotQ8LBW32e-75LBD12_ARATH; LOB domain-containing protein 12
TrEMBLA0A0K9QFW05e-84A0A0K9QFW0_SPIOL; Uncharacterized protein
STRINGPOPTR_0010s19180.14e-80(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G30130.19e-77LBD family protein